PE001856

From GPTWiki
Jump to navigation Jump to search
Name K.NLASRPYTFHSHGITYYKEHEGAIYPDN[H5N4F3S]TTDFQR.A
Sequence NLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQR
Glycans(s) H5N4F3S (N28)
Mod(s)
Molecular Weight 6397.749
Norm. RT
Protein CP (P00450)

Samples

DDA Transition Groups