PE001773

From GPTWiki
Jump to navigation Jump to search
Name R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3F]STEAGQK.L
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N3F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5293.370
Norm. RT 53.978
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00469835.12835.38354.012880.2396OrbitrapHuman ACE2 Protein15
TG00471435.12835.35653.9441,056.0855OrbitrapHuman ACE2 Protein15