PE001772

From GPTWiki
Jump to navigation Jump to search
Name R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N4F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5496.450
Norm. RT 53.804
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00471335.30435.28253.7561,096.7015OrbitrapHuman ACE2 Protein15
TG00472635.30435.30153.804914.0856OrbitrapHuman ACE2 Protein8
TG00477535.36935.36953.864914.0856OrbitrapHuman ACE2 Protein9