PE001770

From GPTWiki
Jump to navigation Jump to search
Name R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4FS]STEAGQK.L
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H5N4FS (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 6111.651
Norm. RT 59.444
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00467037.49337.48159.3371,016.6196OrbitrapHuman ACE2 Protein23
TG00467937.49337.56559.5501,219.7415OrbitrapHuman ACE2 Protein18