PE001763

From GPTWiki
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4S]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4S (N27)
Mod(s)
Molecular Weight 7575.283
Norm. RT 152.988
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00468674.84774.580153.4881,512.4625OrbitrapHuman ACE2 Protein4
TG00477874.81374.637152.4871,512.4625OrbitrapHuman ACE2 Protein6