PE001762

From GPTWiki
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4FS]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4FS (N27)
Mod(s)
Molecular Weight 7559.288
Norm. RT 154.502
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00468975.00875.193155.0441,509.2635OrbitrapHuman ACE2 Protein14
TG00477275.34475.223153.9591,509.2635OrbitrapHuman ACE2 Protein14