PE001761

From GPTWiki
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N5]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N5 (N27)
Mod(s)
Molecular Weight 7163.161
Norm. RT 144.520
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00465371.52571.046144.5201,430.0385OrbitrapHuman ACE2 Protein4
TG00483571.33568.905138.0911,430.0385OrbitrapHuman ACE2 Protein4