PE001757

From GPTWiki
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N4F]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N4F (N27)
Mod(s)
Molecular Weight 7106.140
Norm. RT 144.984
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00464071.06271.326145.2301,418.6345OrbitrapHuman ACE2 Protein8
TG00481071.82771.552144.7391,418.6345OrbitrapHuman ACE2 Protein10