PE001686

From GPTWiki
Jump to navigation Jump to search
Name R.IFKEAEKFFVSVGLPN[H3N5F]MTQGFWENSMLTDPGNVQK.A
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H3N5F (N16)
Mod(s)
Molecular Weight 5653.578
Norm. RT 129.160
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00473066.04264.994129.1601,409.9004OrbitrapHuman ACE2 Protein5