PE001685

From GPTWiki
Jump to navigation Jump to search
Name R.IFKEAEKFFVSVGLPN[H3N3F]MTQGFWENSMLTDPGNVQK.A
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H3N3F (N16)
Mod(s)
Molecular Weight 5247.419
Norm. RT 130.579
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00475066.00065.553130.5791,308.3604OrbitrapHuman ACE2 Protein9