PE001683

From GPTWiki
Jump to navigation Jump to search
Name R.IFKEAEKFFVSVGLPN[H6N5F3]MTQGFWENSMLTDPGNVQK.A
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H6N5F3 (N16)
Mod(s)
Molecular Weight 6431.852
Norm. RT
Protein ACE2 (Q9BYF1)

Samples

DDA Transition Groups