PE001682

From GPTWiki
Jump to navigation Jump to search
Name R.IFKEAEKFFVSVGLPN[H3N4F]MTQGFWENSMLTDPGNVQK.A
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H3N4F (N16)
Mod(s)
Molecular Weight 5450.498
Norm. RT 129.259
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00466966.14965.033129.2591,359.1304OrbitrapHuman ACE2 Protein8