PE001667

From GPTWiki
Jump to navigation Jump to search
Name K.EAEKFFVSVGLPN[H3N3F]MTQGFWENSMLTDPGNVQK.A
Sequence EAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H3N3F (N13)
Mod(s)
Molecular Weight 4859.172
Norm. RT 118.102
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00465660.42960.578117.9531,211.2984OrbitrapHuman ACE2 Protein7
TG00481260.51661.006118.2521,211.2984OrbitrapHuman ACE2 Protein8