PE001555

From GPTWiki
Jump to navigation Jump to search
Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N5F]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H5N5F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6540.955
Norm. RT 63.409
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00430039.45640.67866.7371,088.1676OrbitrapSARS-CoV-2 Spike Protein4
TG00411839.30137.88560.121932.8597OrbitrapSARS-CoV-2 Spike Protein17
TG00432839.45639.34163.409932.8597OrbitrapSARS-CoV-2 Spike Protein18