PE001546

From GPTWiki
Jump to navigation Jump to search
Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS3]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS3 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7941.426
Norm. RT
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00416946.62246.62982.1151,132.9267OrbitrapSARS-CoV-2 Spike Protein7