PE001542

From GPTWiki
Jump to navigation Jump to search
Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N3F]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H4N3F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 5972.744
Norm. RT 64.793
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00419639.91739.89764.793851.6867OrbitrapSARS-CoV-2 Spike Protein14
TG00418339.43939.11463.213993.4656OrbitrapSARS-CoV-2 Spike Protein15
TG00414339.43940.36066.347851.6867OrbitrapSARS-CoV-2 Spike Protein13