PE001381

From GPTWiki
Jump to navigation Jump to search
Name K.IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYN[H5N4S]K.S
Sequence IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNK
Glycans(s) H5N4S (N33)
Mod(s) 57.021 (C22)
Molecular Weight 5547.429
Norm. RT 122.207
Protein TF (P02787)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00331761.81461.878122.2391,383.3664OrbitrapHuman Serum4
TG00343461.81461.853122.1741,106.8945OrbitrapHuman Serum7