PE001380

From GPTWiki
Jump to navigation Jump to search
Name K.IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYN[H5N4S2]K.S
Sequence IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNK
Glycans(s) H5N4S2 (N33)
Mod(s) 57.021 (C22)
Molecular Weight 5838.524
Norm. RT 135.702
Protein TF (P02787)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00335167.33367.036135.7021,456.1394OrbitrapHuman Serum5