PE001281

From GPTWiki
Jump to navigation Jump to search
Name R.QLAHQSN[H5N4S]STNIFFSPVSIATAFAM[Ox]LSLGTK.A
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5128.310
Norm. RT
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00294379.37579.388165.6571,278.5834OrbitrapHuman Serum4