PE001275

From GPTWiki
Jump to navigation Jump to search
Name K.TKPREEQYN[H3N3F]STYRVVSVLTVLHQDWLNGKEYK.C
Sequence TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
Glycans(s) H3N3F (N9)
Mod(s)
Molecular Weight 5139.456
Norm. RT
Protein IGHG1 (P01857)

Samples

NIST IgG Standard

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00290368.8611,025.2975QExactiveNIST IgG Standard7
TG00291068.856854.5826QExactiveNIST IgG Standard13
TG00290968.8561,025.2975QExactiveNIST IgG Standard10