PE001258

From GPTWiki
Jump to navigation Jump to search
Name K.GTEDFIVESLDASFRYPQDYQFYIQN[H8N2]FTALPLNTVVPPQR.Q
Sequence GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR
Glycans(s) H8N2 (N26)
Mod(s)
Molecular Weight 6398.894
Norm. RT 158.708
Protein SSR1 (P43307)

Samples

HEK293 Cells

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00287877.33277.393161.2051,596.2294OrbitrapHEK293 Cells5
TG00639377.81477.759156.2111,596.2294OrbitrapHEK293 Cells4