PE001257

From GPTWiki
Jump to navigation Jump to search
Name K.GHDLNEDGLVSWEEYKN[H3N3F]ATYGYVLDDPDPDDGFNYK.Q
Sequence GHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYK
Glycans(s) H3N3F (N17)
Mod(s)
Molecular Weight 5409.268
Norm. RT
Protein CALU (O43852)

Samples

DDA Transition Groups