PE001256

From GPTWiki
Jump to navigation Jump to search
Name K.GHDLNEDGLVSWEEYKN[H3N4F]ATYGYVLDDPDPDDGFNYK.Q
Sequence GHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYK
Glycans(s) H3N4F (N17)
Mod(s)
Molecular Weight 5612.347
Norm. RT
Protein CALU (O43852)

Samples

HEK293 Cells

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00638349.91949.8181,399.5924OrbitrapHEK293 Cells4