PE001249

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H7N6FS4]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H7N6FS4 (N4)
Mod(s)
Molecular Weight 7203.075
Norm. RT 185.707
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00284985.45485.301185.7071,438.0215OrbitrapHuman Serum12