PE001248

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H7N6S4]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H7N6S4 (N4)
Mod(s)
Molecular Weight 7057.017
Norm. RT 191.137
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00521088.41488.465194.8771,408.8095OrbitrapHuman Serum8
TG00285686.12485.967187.3961,408.8095OrbitrapHuman Serum11