PE001186
Jump to navigation
Jump to search
Name | K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L |
---|---|
Sequence | SSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYK |
Glycans(s) | H9N2 (N14) |
Mod(s) | |
Molecular Weight | 5746.624 |
Norm. RT | 158.132 |
Protein | APOB (P04114) |
Samples
DDA Transition Groups
Exp. R.T. | Peak R.T. | Norm. R.T. | Prec. m/z | Prec. z | Inst. | Sample | Transitions | |
---|---|---|---|---|---|---|---|---|
TG002793 | 74.067 | 74.532 | 158.132 | 1,433.161 | 4 | Orbitrap | Human Serum | 14 |
DIA Transition Groups
Exp. R.T. | Peak R.T. | Norm. R.T. | Prec. m/z | Prec. z | Inst. | Sample | Intensity | |
---|---|---|---|---|---|---|---|---|
TG006444 | 78.536 | 78.536 | 163.768 | 1,433.161 | 4 | Orbitrap | Human Serum | 651,377 |
TG009073 | 57.299 | 57.299 | 182.795 | 1,433.161 | 4 | TripleTOF | Human Serum | 267,945 |
TG008160 | 56.931 | 56.931 | 171.664 | 1,433.161 | 4 | TripleTOF | Human Serum | 222,606 |
TG008765 | 59.784 | 59.784 | 195.916 | 1,433.161 | 4 | TripleTOF | Human Serum | 132,225 |
TG008467 | 59.264 | 59.264 | 196.736 | 1,433.161 | 4 | TripleTOF | Human Serum | 100,136 |
TG010186 | 56.733 | 56.733 | 177.018 | 1,433.161 | 4 | TripleTOF | Human Serum | 84,376.7 |
TG009745 | 56.598 | 56.598 | 181.705 | 1,433.161 | 4 | TripleTOF | Human Serum | 72,229.1 |
TG010595 | 59.061 | 59.061 | 187.767 | 1,433.161 | 4 | TripleTOF | Human Serum | 54,241.3 |