PE001184

From GPTWiki
Jump to navigation Jump to search
Name R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5419.406
Norm. RT 171.257
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00497188.09888.598170.6891,351.3574OrbitrapHuman Serum7
TG00492388.99789.154171.3501,351.3574OrbitrapHuman Serum8
TG00279585.53885.364185.5841,351.3574OrbitrapHuman Serum7
TG00279886.07886.292178.9941,351.3574OrbitrapHuman Serum8
TG00487288.99789.115171.2571,081.2875OrbitrapHuman Serum8

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG01025161.30861.308198.1151,081.2875TripleTOFHuman Serum85,193.2
TG01007361.31261.312198.1321,351.3574TripleTOFHuman Serum85,005.1
TG00980561.15061.150203.8831,081.2875TripleTOFHuman Serum61,950.1
TG00963761.15161.151203.8881,351.3574TripleTOFHuman Serum56,572.3
TG01065262.72562.725204.7551,081.2875TripleTOFHuman Serum47,662.6