PE001181

From GPTWiki
Jump to navigation Jump to search
Name R.LYHFLLGAWSLN[H5N4S2]ATELDPCPLSPELLGLTK.E
Sequence LYHFLLGAWSLNATELDPCPLSPELLGLTK
Glycans(s) H5N4S2 (N12)
Mod(s) 57.021 (C19)
Molecular Weight 5590.536
Norm. RT 171.457
Protein PGLYRP2 (Q96PD5)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00279280.21080.206172.4991,394.1424OrbitrapHuman Serum6
TG00344980.65980.436170.4161,394.1424OrbitrapHuman Serum4

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00915355.96555.965176.5751,394.1424TripleTOFHuman Serum26,111.5
TG00823356.01356.013167.6661,394.1424TripleTOFHuman Serum19,148
TG00883657.13157.131182.8591,394.1424TripleTOFHuman Serum17,047.2
TG00945057.22257.222179.5521,394.1424TripleTOFHuman Serum15,866.6