PE001142

From GPTWiki
Jump to navigation Jump to search
Name K.LVLSSEKTVLTPATNHM[Ox]GN[H5N2F]VTFTIPANREFK.S
Sequence LVLSSEKTVLTPATNHMGNVTFTIPANREFK
Glycans(s) H5N2F (N19)
Mod(s) 15.995 (M17)
Molecular Weight 4811.283
Norm. RT
Protein C3 (P01024)

Samples

DDA Transition Groups