PE001086

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H7N6S]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H7N6S (N4)
Mod(s)
Molecular Weight 6183.731
Norm. RT
Protein SERPINA3 (P01011)

Samples

DDA Transition Groups