PE001071

From GPTWiki
Jump to navigation Jump to search
Name K.SLGNVN[H5N3]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H5N3 (N6)
Mod(s) 57.021 (C20)
Molecular Weight 4978.228
Norm. RT
Protein A2M (P01023)

Samples

DDA Transition Groups