PE000968

From GPTWiki
Jump to navigation Jump to search
Name K.TKPREEQYN[H4N3F]STYRVVSVLTVLHQDWLNGKEYK.C
Sequence TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
Glycans(s) H4N3F (N9)
Mod(s)
Molecular Weight 5301.509
Norm. RT
Protein IGHG1 (P01857)

Samples

NIST IgG Standard

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00226369.376881.5916QExactiveNIST IgG Standard14
TG00226469.3761,057.7075QExactiveNIST IgG Standard7
TG00221569.1611,057.7075QExactiveNIST IgG Standard4