PE000880

From GPTWiki
Jump to navigation Jump to search
Name K.LVLSSEKTVLTPATNHMGN[H7N2]VTFTIPANREFK.S
Sequence LVLSSEKTVLTPATNHMGNVTFTIPANREFK
Glycans(s) H7N2 (N19)
Mod(s)
Molecular Weight 4973.336
Norm. RT
Protein C3 (P01024)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00201033.7251,239.8394OrbitrapHuman Serum10