PE000818

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H5N4F2S]ASALFILPDQDKMEEVEAMLLPETLK.R
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H5N4F2S (N4)
Mod(s)
Molecular Weight 5589.481
Norm. RT
Protein SERPINA3 (P01011)

Samples

DDA Transition Groups