PE000782

From GPTWiki
Jump to navigation Jump to search
Name K.SLGNVN[H6N3S]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H6N3S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5431.377
Norm. RT
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00177339.03039.0651,354.3524OrbitrapHuman Serum10