PE000780

From GPTWiki
Jump to navigation Jump to search
Name R.QLAHQSN[H6N4FS]STNIFFSPVSIATAFAMLSLGTK.A
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H6N4FS (N7)
Mod(s)
Molecular Weight 5420.426
Norm. RT
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00179485.35185.3161,081.4915OrbitrapHuman Serum5