PE000718

From GPTWiki
Jump to navigation Jump to search
Name K.TKPREEQYN[H5N2]STYRVVSVLTVLHQDWLNGKEYK.C
Sequence TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
Glycans(s) H5N2 (N9)
Mod(s)
Molecular Weight 5114.424
Norm. RT
Protein IGHG1 (P01857)

Samples

NIST IgG Standard

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00165869.2821,020.2915QExactiveNIST IgG Standard6