PE000714
Jump to navigation
Jump to search
Name | K.TKPREEQYN[H4N4F]STYRVVSVLTVLHQDWLNGKEYK.C |
---|---|
Sequence | TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK |
Glycans(s) | H4N4F (N9) |
Mod(s) | |
Molecular Weight | 5504.588 |
Norm. RT | |
Protein | IGHG1 (P01857) |
Samples
DDA Transition Groups
Exp. R.T. | Peak R.T. | Norm. R.T. | Prec. m/z | Prec. z | Inst. | Sample | Transitions | |
---|---|---|---|---|---|---|---|---|
TG001673 | 54.951 | 1,372.652 | 4 | QExactive | NIST IgG Standard | 5 | ||
TG001642 | 68.885 | 915.437 | 6 | QExactive | NIST IgG Standard | 12 | ||
TG001709 | 52.992 | 915.437 | 6 | QExactive | NIST IgG Standard | 8 | ||
TG001700 | 59.405 | 915.437 | 6 | QExactive | NIST IgG Standard | 11 | ||
TG000509 | 69.504 | 915.437 | 6 | QExactive | NIST IgG Standard | 14 | ||
TG001660 | 54.951 | 1,098.323 | 5 | QExactive | NIST IgG Standard | 24 | ||
TG001678 | 54.951 | 915.437 | 6 | QExactive | NIST IgG Standard | 10 | ||
TG001634 | 68.885 | 1,372.652 | 4 | QExactive | NIST IgG Standard | 9 | ||
TG001615 | 68.885 | 1,098.323 | 5 | QExactive | NIST IgG Standard | 12 | ||
TG000524 | 69.504 | 1,098.323 | 5 | QExactive | NIST IgG Standard | 9 | ||
TG001573 | 69.140 | 915.437 | 6 | QExactive | NIST IgG Standard | 15 | ||
TG001578 | 69.140 | 1,098.323 | 5 | QExactive | NIST IgG Standard | 8 |