PE000714

From GPTWiki
Jump to navigation Jump to search
Name K.TKPREEQYN[H4N4F]STYRVVSVLTVLHQDWLNGKEYK.C
Sequence TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
Glycans(s) H4N4F (N9)
Mod(s)
Molecular Weight 5504.588
Norm. RT
Protein IGHG1 (P01857)

Samples

NIST IgG Standard

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00167354.9511,372.6524QExactiveNIST IgG Standard5
TG00164268.885915.4376QExactiveNIST IgG Standard12
TG00170952.992915.4376QExactiveNIST IgG Standard8
TG00170059.405915.4376QExactiveNIST IgG Standard11
TG00050969.504915.4376QExactiveNIST IgG Standard14
TG00166054.9511,098.3235QExactiveNIST IgG Standard24
TG00167854.951915.4376QExactiveNIST IgG Standard10
TG00163468.8851,372.6524QExactiveNIST IgG Standard9
TG00161568.8851,098.3235QExactiveNIST IgG Standard12
TG00052469.5041,098.3235QExactiveNIST IgG Standard9
TG00157369.140915.4376QExactiveNIST IgG Standard15
TG00157869.1401,098.3235QExactiveNIST IgG Standard8