PE000713

From GPTWiki
Jump to navigation Jump to search
Name K.TKPREEQYN[H3N4F]STYRVVSVLTVLHQDWLNGKEYK.C
Sequence TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
Glycans(s) H3N4F (N9)
Mod(s)
Molecular Weight 5342.535
Norm. RT
Protein IGHG1 (P01857)

Samples

NIST IgG Standard

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00051168.4321,065.9135QExactiveNIST IgG Standard7
TG00167452.742761.6547QExactiveNIST IgG Standard9
TG00171153.6001,332.1394QExactiveNIST IgG Standard4
TG00170853.600888.4296QExactiveNIST IgG Standard8
TG00168859.161888.4296QExactiveNIST IgG Standard10
TG00161669.044888.4296QExactiveNIST IgG Standard10
TG00161869.0441,065.9135QExactiveNIST IgG Standard13
TG00171053.6001,065.9135QExactiveNIST IgG Standard8
TG00168152.7421,065.9135QExactiveNIST IgG Standard21
TG00160853.847761.6547QExactiveNIST IgG Standard15
TG00169559.1611,065.9135QExactiveNIST IgG Standard10
TG00167652.742888.4296QExactiveNIST IgG Standard9
TG00155568.432888.4296QExactiveNIST IgG Standard12
TG00157769.268888.4296QExactiveNIST IgG Standard12
TG00160269.2681,065.9135QExactiveNIST IgG Standard11