PE000713
Jump to navigation
Jump to search
Name | K.TKPREEQYN[H3N4F]STYRVVSVLTVLHQDWLNGKEYK.C |
---|---|
Sequence | TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK |
Glycans(s) | H3N4F (N9) |
Mod(s) | |
Molecular Weight | 5342.535 |
Norm. RT | |
Protein | IGHG1 (P01857) |
Samples
DDA Transition Groups
Exp. R.T. | Peak R.T. | Norm. R.T. | Prec. m/z | Prec. z | Inst. | Sample | Transitions | |
---|---|---|---|---|---|---|---|---|
TG001618 | 69.044 | 1,065.913 | 5 | QExactive | NIST IgG Standard | 13 | ||
TG001710 | 53.600 | 1,065.913 | 5 | QExactive | NIST IgG Standard | 8 | ||
TG001681 | 52.742 | 1,065.913 | 5 | QExactive | NIST IgG Standard | 21 | ||
TG001608 | 53.847 | 761.654 | 7 | QExactive | NIST IgG Standard | 15 | ||
TG001695 | 59.161 | 1,065.913 | 5 | QExactive | NIST IgG Standard | 10 | ||
TG001676 | 52.742 | 888.429 | 6 | QExactive | NIST IgG Standard | 9 | ||
TG001555 | 68.432 | 888.429 | 6 | QExactive | NIST IgG Standard | 12 | ||
TG001577 | 69.268 | 888.429 | 6 | QExactive | NIST IgG Standard | 12 | ||
TG001602 | 69.268 | 1,065.913 | 5 | QExactive | NIST IgG Standard | 11 | ||
TG000511 | 68.432 | 1,065.913 | 5 | QExactive | NIST IgG Standard | 7 | ||
TG001674 | 52.742 | 761.654 | 7 | QExactive | NIST IgG Standard | 9 | ||
TG001711 | 53.600 | 1,332.139 | 4 | QExactive | NIST IgG Standard | 4 | ||
TG001708 | 53.600 | 888.429 | 6 | QExactive | NIST IgG Standard | 8 | ||
TG001688 | 59.161 | 888.429 | 6 | QExactive | NIST IgG Standard | 10 | ||
TG001616 | 69.044 | 888.429 | 6 | QExactive | NIST IgG Standard | 10 |