PE000670

From GPTWiki
Jump to navigation Jump to search
Name K.GGETAQSADPQWEQLNNKN[H6N5FS3]LSMPLLPADFHK.E
Sequence GGETAQSADPQWEQLNNKNLSMPLLPADFHK
Glycans(s) H6N5FS3 (N19)
Mod(s)
Molecular Weight 6460.720
Norm. RT 101.889
Protein SERPIND1 (P05546)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00146552.57752.494101.8891,289.5505OrbitrapHuman Serum14