PE000585

From GPTWiki
Jump to navigation Jump to search
Name R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5S3]YSCSYR.T
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H6N5S3 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6714.680
Norm. RT 96.595
Protein A1BG (P04217)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00131450.92650.88996.3051,340.3445OrbitrapHuman Serum10
TG00134650.92650.85496.2181,675.1784OrbitrapHuman Serum10
TG00124350.71550.59697.3001,340.3445OrbitrapHuman Serum13
TG00189350.50250.72096.8841,340.3445OrbitrapHuman Serum13