PE000490

From GPTWiki
Jump to navigation Jump to search
Name K.GGETAQSADPQWEQLNNKN[H5N4]LSMPLLPADFHK.E
Sequence GGETAQSADPQWEQLNNKNLSMPLLPADFHK
Glycans(s) H5N4 (N19)
Mod(s)
Molecular Weight 5076.244
Norm. RT 67.503
Protein SERPIND1 (P05546)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00097739.16939.11767.5031,265.5664OrbitrapHuman Serum8