PE000489

From GPTWiki
Jump to navigation Jump to search
Name K.GGETAQSADPQWEQLNNKN[H5N4S2]LSMPLLPADFHK.E
Sequence GGETAQSADPQWEQLNNKNLSMPLLPADFHK
Glycans(s) H5N4S2 (N19)
Mod(s)
Molecular Weight 5658.435
Norm. RT 90.060
Protein SERPIND1 (P05546)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00274247.73447.67190.3161,411.1144OrbitrapHuman Serum13
TG00102947.77047.79190.0411,129.0935OrbitrapHuman Serum14
TG00145848.40947.86290.0601,411.1144OrbitrapHuman Serum10

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00825339.20439.20494.4521,129.0935TripleTOFHuman Serum67,406.9
TG00917239.03339.03397.6271,129.0935TripleTOFHuman Serum49,559.5
TG00856339.69139.69199.2161,129.0935TripleTOFHuman Serum48,619.3
TG00946940.02540.02599.4391,129.0935TripleTOFHuman Serum47,456.7
TG00813039.21139.21194.4811,411.1144TripleTOFHuman Serum40,708.8
TG01032539.16039.16095.9971,129.0935TripleTOFHuman Serum30,159.1
TG00987738.98838.98895.9281,129.0935TripleTOFHuman Serum29,589.3
TG00935040.03140.03199.4701,411.1144TripleTOFHuman Serum22,416