PE000412

From GPTWiki
Jump to navigation Jump to search
Name R.QLDMLDLSN[H6N5FS3]NSLASVPEGLWASLGQPNWDM.R
Sequence QLDMLDLSNNSLASVPEGLWASLGQPNWDM
Glycans(s) H6N5FS3 (N9)
Mod(s)
Molecular Weight 6325.612
Norm. RT
Protein LRG1 (P02750)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00052533.69333.6251,577.9084OrbitrapHuman Serum30