PE000403

From GPTWiki
Jump to navigation Jump to search
Name -.MGPLMVLFCLLFLYPGLADSAPSCPQNVN[H6N5FS3]ISG.G
Sequence MGPLMVLFCLLFLYPGLADSAPSCPQNVNISG
Glycans(s) H6N5FS3 (N29)
Mod(s) 57.021 (C9), 57.021 (C24)
Molecular Weight 6505.764
Norm. RT
Protein C2 (P06681)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00037653.7521,298.5645OrbitrapHuman Serum6