PE000380

From GPTWiki
Jump to navigation Jump to search
Name L.GNVN[H5N5F]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence GNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H5N5F (N4)
Mod(s) 57.021 (C18)
Molecular Weight 5330.329
Norm. RT
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00017760.04660.2301,063.4745OrbitrapHuman Serum6