PE000327

From GPTWiki
Jump to navigation Jump to search
Name R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H6N5FS3]LTHLPANLLQGASK.L
Sequence SDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASK
Glycans(s) H6N5FS3 (N32)
Mod(s) 57.021 (C9)
Molecular Weight 7923.502
Norm. RT 192.025
Protein LRG1 (P02750)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00034588.26687.846192.3371,582.1095OrbitrapHuman Serum15
TG00109588.05487.800191.7131,582.1095OrbitrapHuman Serum17
TG00352188.99288.939192.7101,582.1095OrbitrapHuman Serum9
TG00025983.52583.5411,318.5926OrbitrapHuman Serum5
TG00514586.91386.742190.2341,582.1095OrbitrapHuman Serum17