PE000303

From GPTWiki
Jump to navigation Jump to search
Name R.NEEYNKSVQEIQATFFYFTPN[H5N4]KTEDTIFLR.E
Sequence NEEYNKSVQEIQATFFYFTPNKTEDTIFLR
Glycans(s) H5N4 (N21)
Mod(s)
Molecular Weight 5312.371
Norm. RT
Protein ORM1 (P02763), ORM2 (P19652)

Samples

DDA Transition Groups