PE000301

From GPTWiki
Jump to navigation Jump to search
Name K.IITILEEEMN[H5N4]VSVCGLYTYGKPVPGHVTVSICR.K
Sequence IITILEEEMNVSVCGLYTYGKPVPGHVTVSICR
Glycans(s) H5N4 (N10)
Mod(s) 57.021 (C14), 57.021 (C32)
Molecular Weight 5374.480
Norm. RT
Protein A2M (P01023)

Samples

DDA Transition Groups