PE000298

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H6N5]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5 (N4)
Mod(s)
Molecular Weight 5527.503
Norm. RT
Protein SERPINA3 (P01011)

Samples

DDA Transition Groups